PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang05g00410.1
Common NameLR48_Vigan04g255400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 159aa    MW: 17306.4 Da    PI: 6.4893
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang05g00410.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.8e-131458145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +g+WT+eEd++l+ +++ +G g+W++ ++  g+ R++k+c+++ +
   Vang05g00410.1 14 KGAWTKEEDDRLIAYIRAHGEGCWRSLPKAAGLLRCGKSCQEKDN 58
                     79******************************99******98855 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-16561IPR009057Homeodomain-like
PROSITE profilePS5129415.016965IPR017930Myb domain
SuperFamilySSF466896.95E-10961IPR009057Homeodomain-like
SMARTSM007172.6E-81363IPR001005SANT/Myb domain
PfamPF002491.7E-111459IPR001005SANT/Myb domain
CDDcd001676.92E-91661No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLIAYIR AHGEGCWRSL PKAAGLLRCG KSCQEKDNNV  60
LVEVKDSKSP TSERCPDLNL ELSISPPHHE REEGGDEEES KSIARSLCFA CSLGLQNSKD  120
CSCALNAITA NANASTATGY DFLGLKTNPL DYRTLQMK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-177AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014499816.14e-57PREDICTED: myb-related protein 308-like
SwissprotP813937e-34MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0L9UI355e-59A0A0L9UI35_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R9U91e-58A0A0S3R9U9_PHAAN; Uncharacterized protein
STRINGVIT_03s0038g02310.t012e-31(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-33myb domain protein 4
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]